Pseudomonas hygromyciniae: JTY93_19110 Help Entry JTY93_19110       CDS       T09404                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phyg  Pseudomonas hygromyciniae Pathway phyg01100   Metabolic pathways phyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JTY93_19110 (acpP)    00074 Mycolic acid biosynthesis     JTY93_19110 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JTY93_19110 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  QSB38364 LinkDB All DBs Position complement(4286572..4286808) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gaagaagtgaccaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system