Phyllobacterium sp. 628: HB779_11810
Help
Entry
HB779_11810 CDS
T08362
Name
(GenBank) SDR family NAD(P)-dependent oxidoreductase
Organism
phyl
Phyllobacterium sp. 628
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short
adh_short_C2
KR
Epimerase
GDP_Man_Dehyd
NAD_binding_10
Ribosomal_S11
Motif
Other DBs
NCBI-ProteinID:
QND52511
LinkDB
All DBs
Position
complement(2075301..2076053)
Genome browser
AA seq
250 aa
AA seq
DB search
MISDGSFRLDGKLALVTGASRGIGYFLAKELAGRGAHVIAVARTVGGLEELDDEITAAGG
TATLVPLDLTDMSAIDRLGGSIHERWGKLDVLVANAGVLGTISPIGHVEAKVFDKLMNIN
VSSVWRLIRTTDPLLKLSDAGRAILLSSGAAHSARAYWGPYAASKAAVEALGRSWADETR
QTRLRVNSVNPGATRTAMRAQAVPGEDPETLPTPAEVAAKIVLLADPALDATGKIYDVRA
DKLLSYNNPS
NT seq
753 nt
NT seq
+upstream
nt +downstream
nt
atgatttctgacggcagttttcggctggacggcaagcttgcgcttgtcaccggcgcatcc
cgtggcattggctactttcttgccaaagaacttgctggccgcggtgcccatgtcattgcc
gttgcccggaccgttggcggtctggaagaactcgacgatgaaatcacggcagcgggcggc
acggcaacgctggttccgctcgatctgaccgacatgtccgccatcgaccggctcggtggt
tcgatccacgagcgttggggcaagctggatgtgctggtagccaatgcgggcgttctgggc
acgatttcgccaattggccatgtggaagccaaagtcttcgacaagttgatgaacatcaac
gtgtccagtgtctggcggctaatccgcaccacagatccgctgctgaagctctcagacgcg
ggacgggctattttgctgtcatcgggcgccgcacactccgcccgcgcctactggggcccc
tatgcggcttccaaggccgctgtcgaggccctggggcgcagctgggccgatgaaacgcgc
cagaccaggttgcgggtcaattcggtcaatccgggtgcgacgcgcacagccatgcgcgcg
caggccgtgccgggggaagaccctgaaacattgccgacaccggccgaggttgctgccaag
attgtgctgctcgccgatccggcgctcgatgcaactggcaaaatctatgatgtgcgtgcc
gacaagctactgagctataataatccgagctag
DBGET
integrated database retrieval system