Phyllobacterium sp. 628: HB779_11875 Help Entry HB779_11875       CDS       T08362                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phyl  Phyllobacterium sp. 628 Pathway phyl00998   Biosynthesis of various antibiotics phyl01100   Metabolic pathways phyl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phyl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HB779_11875    00074 Mycolic acid biosynthesis     HB779_11875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HB779_11875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QND52524 UniProt:  A0A7G6SDE2 LinkDB All DBs Position 2090170..2090406 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDAEKVTDGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatactgcagaacgcgtcaagaaaatcgttattgagcatctgggcgttgatgcc gagaaagtcaccgatggtgcgagcttcatcgacgatctgggcgcagacagccttgataca gtcgagctcgtgatggctttcgaagaagagttcggcgtcgaaattccggacgatgctgct gagacgattctgacagtcggcgatgccgtcaagttcatcgacaaagcatctgcctga

DBGET integrated database retrieval system