Phyllobacterium sp. 628: HB779_13950 Help Entry HB779_13950       CDS       T08362                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism phyl  Phyllobacterium sp. 628 Pathway phyl02024   Quorum sensing phyl03018   RNA degradation Brite KEGG Orthology (KO) [BR:phyl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HB779_13950 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HB779_13950 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:phyl03019]     HB779_13950 (hfq)    03036 Chromosome and associated proteins [BR:phyl03036]     HB779_13950 (hfq) Messenger RNA biogenesis [BR:phyl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HB779_13950 (hfq) Chromosome and associated proteins [BR:phyl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HB779_13950 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QND52886 LinkDB All DBs Position 2524142..2524387 Genome browser AA seq 81 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEAEAEDSD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcagaatcttcaggatctttttctgaactccgtcagaaaacagaag atttctctgacaattttcctcattaacggcgtcaaactgaccggtattgtcacctcgttc gacaatttctgcgtgctgttgcgccgcgacggccattcccagctcgtttacaaacacgcc atctcgactatcatgccgagccagcctgtacagatgttcgaagctgaggccgaagacagc gactga

DBGET integrated database retrieval system