Porphyrobacter sp. HT-58-2: CHX26_11610 Help Entry CHX26_11610       CDS       T05364                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phz  Porphyrobacter sp. HT-58-2 Pathway phz01100   Metabolic pathways phz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHX26_11610    00074 Mycolic acid biosynthesis     CHX26_11610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHX26_11610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUX70045 UniProt:  A0A2L0GL66 LinkDB All DBs Position 2468887..2469174 Genome browser AA seq 95 aa AA seqDB search MNTSANIDSEAGLDRELKSLIADVLGLDPSQADAFGPESGLFGHLPELDSMAVAGLLTEM EDRLGIVIEDDDVTGEMLETYGGLLAFAQAKLAHR NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacacctctgcgaacatcgacagcgaagctgggcttgaccgcgaactcaagagcttg atcgccgacgtgctaggcctcgatccgtcgcaggccgatgccttcggccctgagtcggga ctgttcggccacttgccggagctggattcgatggcggtcgcagggctcctcaccgaaatg gaagaccggctcggcatcgtgatcgaggatgacgatgtgaccggcgaaatgctggaaacc tatggtggcctgctcgctttcgcgcaggccaagcttgcccaccgctag

DBGET integrated database retrieval system