Paenibacillus ihbetae: BBD41_15770 Help Entry BBD41_15770       CDS       T05154                                  Name (GenBank) prohead protease   KO K03116   sec-independent protein translocase protein TatA Organism pib  Paenibacillus ihbetae Pathway pib03060   Protein export pib03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pib00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BBD41_15770  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BBD41_15770  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pib02044]     BBD41_15770 Secretion system [BR:pib02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BBD41_15770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E OppC_N Motif Other DBs NCBI-ProteinID:  ANY73916 UniProt:  A0A1B2E1P9 LinkDB All DBs Position complement(3583627..3583854) Genome browser AA seq 75 aa AA seqDB search MPFGNIGIGGLILILIIALIIFGPSKLPELGRAFGRTLSEFKGATRGLVNGDDENEDGKK DDAPKAAAAAGKQGS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgccgtttggcaatatcgggatcggtggcttaatcttgattttaattatcgccttgatc atcttcgggccttccaagctacctgagctgggacgggcattcggcagaaccctgagcgaa ttcaaaggcgcaacccggggcttggtgaacggggatgatgagaatgaggacgggaagaaa gacgatgctcctaaagcggctgctgcagcgggcaagcaaggcagctaa

DBGET integrated database retrieval system