Scheffersomyces stipitis: PICST_34179 Help Entry PICST_34179       CDS       T01023                                  Symbol URM12 Name (RefSeq) ubiquitin-like protein   KO K12161   ubiquitin related modifier 1 Organism pic  Scheffersomyces stipitis Pathway pic04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:pic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     PICST_34179 (URM12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:pic03016]     PICST_34179 (URM12)    04121 Ubiquitin system [BR:pic04121]     PICST_34179 (URM12) Transfer RNA biogenesis [BR:pic03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     PICST_34179 (URM12) Ubiquitin system [BR:pic04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PICST_34179 (URM12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 Orbi_VP3 ThiS Motif Other DBs NCBI-GeneID:  4851075 NCBI-ProteinID:  XP_001387399 JGI:  34179 UniProt:  A3GFM6 LinkDB All DBs Position 1:<879622..>879927 Genome browser AA seq 101 aa AA seqDB search MGFKVKVEFLGGLDVISNKVREHSLKVPLEEGEATVKDLIELITKSIIADPKDIPVFIED DTVRPGILVLINDTDWELEGMEEYVLESGDVFTFTSTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgggcttcaaagttaaggtagagttccttggtggcttagatgtcatctccaacaaagtc agagaacactccttgaaggttccgctcgaggaaggtgaagctaccgttaaagacttgatc gagctcatcacaaagtccatcattgctgatccaaaagatataccagtattcatagaagat gataccgttcgtccgggcattcttgttcttatcaacgacaccgattgggaattggaaggc atggaagagtacgttcttgagtctggcgatgtgtttacttttaccagtacattgcatgga ggttag

DBGET integrated database retrieval system