Scheffersomyces stipitis: PICST_54635 Help Entry PICST_54635       CDS       T01023                                  Name (RefSeq) predicted protein   KO K10418   dynein light chain LC8-type Organism pic  Scheffersomyces stipitis Pathway pic04814   Motor proteins Brite KEGG Orthology (KO) [BR:pic00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PICST_54635  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pic03037]     PICST_54635    04812 Cytoskeleton proteins [BR:pic04812]     PICST_54635 Cilium and associated proteins [BR:pic03037]  Motile cilia and associated proteins   Dynein arm    PICST_54635 Cytoskeleton proteins [BR:pic04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PICST_54635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Imm48 DUF5622 DUF3646 Motif Other DBs NCBI-GeneID:  4837355 NCBI-ProteinID:  XP_001382827 JGI:  54635 UniProt:  A3LN47 LinkDB All DBs Position 2:complement(326079..326342) Genome browser AA seq 87 aa AA seqDB search MRSTVILKASDLPEEIQTKVFELAEQSLSYKVEKDIAAYLKKELDQLYGPTWHVIVGRSF GSYVTHEQGYFIYFYLGDLAFLAFKSG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcgatctacagtcatcctaaaagcttcagacctacccgaagagatccaaacaaaggtc tttgagttggcggaacagtcgttatcatacaaagttgaaaaggatatcgcagcctatctc aagaaagaattggatcagttatatggacccacttggcatgtgattgtggggcgaagcttt ggcagctatgtgacccacgaacagggctatttcatctacttctacctcggtgatctcgcc ttccttgcttttaagagtggataa

DBGET integrated database retrieval system