Scheffersomyces stipitis: PICST_61635 Help Entry PICST_61635       CDS       T01023                                  Symbol RPB9 Name (RefSeq) DNA-directed RNA polymerase II   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism pic  Scheffersomyces stipitis Pathway pic03020   RNA polymerase pic03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pic00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PICST_61635 (RPB9)   09124 Replication and repair    03420 Nucleotide excision repair     PICST_61635 (RPB9)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pic03021]     PICST_61635 (RPB9)    03400 DNA repair and recombination proteins [BR:pic03400]     PICST_61635 (RPB9) Transcription machinery [BR:pic03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      PICST_61635 (RPB9) DNA repair and recombination proteins [BR:pic03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PICST_61635 (RPB9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_TFIIS Zn_ribbon_RPB9 Cas12f1-like_TNB DUF3716 DZR RUBY_RBDX Zn_ribbon_recom HVO_0758 Zn_ribbon_Nudix C1_1 Zn_ribbon_13 Zn_Ribbon_1 Motif Other DBs NCBI-GeneID:  4840207 NCBI-ProteinID:  XP_001385993 JGI:  61635 UniProt:  A3LYD6 LinkDB All DBs Position 6:complement(1519303..1519641) Genome browser AA seq 112 aa AA seqDB search MASFRFCAECNNMLYPKEDKDGQRLLYACRNCGYTELAENPKVYRHELITNIGETAGVVQ DIGSDPTLPRSDKECTKCGNKECVFFQSQQRRKDTSMILFYVCLNCKTVFQA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcctcgttccgtttctgcgcagaatgcaacaacatgttatatccaaaagaagacaag gatggccagagattactctatgcctgtcgtaattgtggctatactgagttggcagaaaac ccaaaagtgtacagacacgagttgattacaaacatcggagaaactgctggggttgtccag gacattggaagtgatcctactttacccagatctgataaggaatgtacaaaatgtggtaac aaagagtgtgttttcttccagtcacaacagagaagaaaggatacctctatgatattgttt tatgtctgcttgaactgtaagacagttttccaggcgtaa

DBGET integrated database retrieval system