KEGG   Pseudomonas iranensis: HU724_002150
Entry
HU724_002150      CDS       T07894                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pie  Pseudomonas iranensis
Pathway
pie00430  Taurine and hypotaurine metabolism
pie00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pie00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    HU724_002150 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HU724_002150 (tauD)
Enzymes [BR:pie01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     HU724_002150 (tauD)
SSDB
Motif
Pfam: TauD NUFIP1 LHH
Other DBs
NCBI-ProteinID: QXI23106
LinkDB
Position
complement(486526..487368)
AA seq 280 aa
MSTLNITPLSSALGAQISGVDISQPLSLEQRDAIEQALLKYQVLFFRNQPIEPAQQARFA
HYFGDLHIHPIYPNVPEQPEVLILDTAVTDVRDNAIWHTDVTFLPTPAMGAVLSAKLLPE
FGGDTLWASGIAAYEALSAPMKTLLEGLSATHDFTRSFPLERYGNTPEALAQWEEARRKN
PPLSHPVIRTHPVSGRRSLFVNEGFTSKINELSETESEAILKFLFAHATRPEFTIRWRWQ
KDDIAFWDNRVTQHYAVDDYRPARRVMQRATVLGDVPFFR
NT seq 843 nt   +upstreamnt  +downstreamnt
atgagcaccctcaacatcaccccgttaagctcggccctcggcgcgcagatcagtggcgtc
gacatcagccagccgctgagcctggaacagcgcgacgccatcgagcaggcgctgctcaag
tatcaggtgctgttcttccgcaaccagccgatcgagccggcacagcaggcacgtttcgca
cattatttcggcgacctgcacattcacccgatctacccgaacgtaccggaacaaccggaa
gtactgatcctcgacaccgcagtcaccgacgtgcgcgataacgcgatctggcataccgac
gtgaccttcctgccgacgccggcgatgggcgcagtgctcagcgccaagttgctgccggag
ttcggtggcgacacgttgtgggccagcggcatcgcggcatatgaagcgttgtcggcgccg
atgaaaaccctgctcgaaggtctgagcgccacccacgatttcacccgatcgtttccactc
gagcgctacggcaacacgcctgaagcgctggcgcagtgggaagaagcgcggcgcaagaat
ccaccgctgtcgcacccggtgatccgtacgcacccggtgagcggacggcgctcgctgttc
gtcaatgaaggcttcacttcgaagatcaatgaactgtcggaaaccgagagcgaagcgatc
ctgaagtttctgtttgcccacgcgacacggccggaattcaccattcgctggcgctggcag
aaagacgatattgccttctgggacaaccgcgtgacgcagcattacgcggtggacgattac
cgcccggcgcggcgggtgatgcagcgggcgacggttttgggggatgtgccgttttttcgc
tga

DBGET integrated database retrieval system