Pseudomonas iranensis: HU724_006450 Help Entry HU724_006450      CDS       T07894                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pie  Pseudomonas iranensis Brite KEGG Orthology (KO) [BR:pie00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pie03036]     HU724_006450 (ftsB) Chromosome and associated proteins [BR:pie03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HU724_006450 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB NRBF2 Csm1_N YabA Motif Other DBs NCBI-ProteinID:  QXI23914 LinkDB All DBs Position 1484040..1484318 Genome browser AA seq 92 aa AA seqDB search MRSPYWLFLVLLLLLAGLQYRLWVGNGSLAQVAELKQQIAEQHAENEGLLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccttactggttgtttcttgttttgctcttgctgctggccggtctgcagtac cgcctgtgggtgggcaatggcagtctggcgcaggtcgccgagctgaaacagcagatcgcc gagcaacatgccgaaaacgaaggcctgctggagcgcaaccgggtgatggacgcggaagtc agcgaattgaaaaaaggcatggagaccgttgaagagcgggctcgtcacgaactgggcatg gtcaaggacggcgaaaccctttaccagttggcccaatga

DBGET integrated database retrieval system