Phytophthora infestans: PITG_06691 Help Entry PITG_06691        CDS       T01333                                  Name (RefSeq) cell division control protein 42   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pif  Phytophthora infestans Pathway pif04145   Phagosome pif04148   Efferocytosis pif04620   Toll-like receptor signaling pathway pif05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pif00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PITG_06691    04148 Efferocytosis     PITG_06691  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     PITG_06691  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     PITG_06691  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pif04131]     PITG_06691   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pif04147]     PITG_06691    04031 GTP-binding proteins [BR:pif04031]     PITG_06691 Membrane trafficking [BR:pif04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     PITG_06691  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     PITG_06691   Macropinocytosis    Ras GTPases     PITG_06691  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     PITG_06691 Exosome [BR:pif04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PITG_06691   Exosomal proteins of other body fluids (saliva and urine)    PITG_06691   Exosomal proteins of colorectal cancer cells    PITG_06691   Exosomal proteins of bladder cancer cells    PITG_06691 GTP-binding proteins [BR:pif04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     PITG_06691 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  9472426 NCBI-ProteinID:  XP_002998770 UniProt:  D0N5G5 LinkDB All DBs AA seq 151 aa AA seqDB search MVDNRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVVSRASFENVKSKWLPEIRHH APGVPFILVGTKSDLRDDEETLEKLKEKKLAPITKEQGETLKTELGAYKYMECSALTQKG LKSVFDEAIRCVITNQQNPKAKQRSFKCSIL NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggtagacaacaggcccatcaacctgggactttgggatacagcaggtcaggaagactac gatcgcctgcgtccgctgagctacccacagacagatgtgtttctcatctgcttctctgtc gttagtcgtgcctcgttcgagaacgtcaagtctaagtggctgccagaaatccgtcatcac gctccgggtgtgccgttcattctcgtgggcacgaagtcagatctacgggacgacgaagaa acgctcgaaaagcttaaagagaagaagctcgccccaatcaccaaggagcagggtgagact ctcaaaaccgagctaggtgcgtacaagtatatggaatgctcggcactgacgcagaagggg ctcaagtcggtgttcgacgaggccattcgatgtgtgatcacgaaccagcagaatcccaag gccaagcaacgatcttttaagtgctccattctgtag

DBGET integrated database retrieval system