Phytophthora infestans: PITG_07146 Help Entry PITG_07146        CDS       T01333                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism pif  Phytophthora infestans Pathway pif04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:pif00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     PITG_07146  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pif01009]     PITG_07146   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pif04131]     PITG_07146    03036 Chromosome and associated proteins [BR:pif03036]     PITG_07146   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pif04147]     PITG_07146 Protein phosphatases and associated proteins [BR:pif01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      PITG_07146 Membrane trafficking [BR:pif04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     PITG_07146 Chromosome and associated proteins [BR:pif03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      PITG_07146 Exosome [BR:pif04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    PITG_07146 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_FSTL1 Motif Other DBs NCBI-GeneID:  9465865 NCBI-ProteinID:  XP_002905106 UniProt:  D0N7D9 LinkDB All DBs AA seq 100 aa AA seqDB search MGQQPTEEELFQMISEVDEDMSGAIDFAEFLQVIDNQKDRAAMFEDDSDMNKTGFVRKET LVKIIKGDFGLTINIEEMINKLDVDGSGEIEFDEFKAILT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgggacagcagccgaccgaggaagagttgtttcaaatgattagcgaggttgacgaggac atgagcggagcaattgactttgctgagtttctgcaagtcatcgacaaccaaaaagatcga gccgctatgttcgaagacgatagcgacatgaacaagacagggtttgtgcgcaaagagaca ctggtgaaaatcatcaagggagacttcggtcttactatcaatattgaggaaatgatcaac aagctggatgtggatggcagcggagagatcgaatttgacgagttcaaggccattctgact tga

DBGET integrated database retrieval system