Phytophthora infestans: PITG_08352 Help Entry PITG_08352        CDS       T01333                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism pif  Phytophthora infestans Pathway pif04145   Phagocytosis pif04814   Motor proteins Brite KEGG Orthology (KO) [BR:pif00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PITG_08352   09142 Cell motility    04814 Motor proteins     PITG_08352  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pif04131]     PITG_08352   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pif03037]     PITG_08352    04812 Cytoskeleton proteins [BR:pif04812]     PITG_08352 Membrane trafficking [BR:pif04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     PITG_08352 Cilium and associated proteins [BR:pif03037]  Motile cilia and associated proteins   Dynein arm    PITG_08352 Cytoskeleton proteins [BR:pif04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PITG_08352 SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 CHASE8 AF0774 Nup54 Motif Other DBs NCBI-GeneID:  9475051 NCBI-ProteinID:  XP_002903747 UniProt:  D0NAE4 LinkDB All DBs AA seq 101 aa AA seqDB search MSEVEETLERIKNHKGVEGYVIADRNGNVLRRHPQMQVAEAEKYAQYMKELTTKARGVVR DLNPKNDLQYMRIRVKKLELLIAHEKDFLVVVIQKWTPTNG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggtggaggaaacattagaacgcatcaagaaccacaagggcgtggaaggctac gtgatcgccgatcgcaatggcaatgtgctgagacgtcacccgcagatgcaagtggccgag gccgaaaagtacgcgcagtacatgaaggagcttaccacaaaggcgcgtggcgtggtacgg gacttgaaccccaagaacgatctgcagtatatgcgcatccgcgtcaagaaactcgagctt ctcatcgctcatgaaaaagactttttagtcgtggtcatccagaagtggacgcctacaaac ggataa

DBGET integrated database retrieval system