Phytophthora infestans: PITG_12754 Help Entry PITG_12754        CDS       T01333                                  Name (RefSeq) dynein light chain 2B   KO K10419   dynein light chain roadblock-type Organism pif  Phytophthora infestans Pathway pif04814   Motor proteins Brite KEGG Orthology (KO) [BR:pif00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PITG_12754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pif04131]     PITG_12754   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pif03037]     PITG_12754    04812 Cytoskeleton proteins [BR:pif04812]     PITG_12754 Membrane trafficking [BR:pif04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     PITG_12754 Cilium and associated proteins [BR:pif03037]  Motile cilia and associated proteins   Dynein arm    PITG_12754 Cytoskeleton proteins [BR:pif04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PITG_12754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Fuz_longin_1 Motif Other DBs NCBI-GeneID:  9478080 NCBI-ProteinID:  XP_002900143 UniProt:  D0NL29 LinkDB All DBs AA seq 109 aa AA seqDB search MPGYEAEETIKRIKSHKGVQAVLIVNQEGVPIYSSTNDDEFAMDHAALISQLAAKAKSTI RTLDPTNDMTFLRIRSKKHEIMIAPDKDYALIVIQNPNPGAEHDTTDSN NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgccgggatacgaagccgaggagaccatcaagcgtatcaagagccacaagggcgtgcaa gccgtactcattgtcaaccaggagggtgtacccatctactcgagcacgaacgatgacgag ttcgctatggaccatgcggcgctcatctcgcagctggcggccaaggccaagtccacgatc cgcactttggaccccacgaacgacatgacttttctccgtattcggtccaagaagcatgag attatgatcgcccctgacaaagactacgcacttatcgtgattcagaatccgaatcctggc gcagagcacgacacgaccgacagtaactga

DBGET integrated database retrieval system