Phytophthora infestans: PITG_15069 Help Entry PITG_15069        CDS       T01333                                  Name (RefSeq) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pif  Phytophthora infestans Pathway pif03010   Ribosome pif04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pif00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PITG_15069   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PITG_15069  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pif03011]     PITG_15069    04121 Ubiquitin system [BR:pif04121]     PITG_15069   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pif04147]     PITG_15069 Ribosome [BR:pif03011]  Ribosomal proteins   Eukaryotes    Small subunit     PITG_15069   Archaea     PITG_15069 Ubiquitin system [BR:pif04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PITG_15069 Exosome [BR:pif04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PITG_15069   Exosomal proteins of colorectal cancer cells    PITG_15069 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L41 ubiquitin Motif Other DBs NCBI-GeneID:  9475879 NCBI-ProteinID:  XP_002898241 UniProt:  D0NRK6 LinkDB All DBs AA seq 107 aa AA seqDB search MHLSIQEGIMQLFVETLSGSPLTLSVAADASVASVKQAVEDVEYIQNFRLVCAGKQLTSG SLADYAVGECDTLKMLLSVNGGMRAKWRKKRMRRLRRKRRKMRQRAR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcatctgagcatccaggagggaataatgcagctctttgtggagaccctatcgggctcc ccgctcacgctcagcgtggcggcggacgcctcggtggcgtcagtcaagcaggccgtcgag gacgtggagtacatccagaacttccgtctggtctgcgccggcaagcagctgacgagcggt tcgctcgctgactacgccgtcggcgagtgcgacacgctcaagatgctgctgtctgtgaac ggtggtatgcgtgccaagtggcgcaagaaacgtatgcgtcgtcttcgccgcaagcgccga aaaatgcgccagcgcgccagataa

DBGET integrated database retrieval system