Pigmentiphaga sp. H8: EGT29_15515 Help Entry EGT29_15515       CDS       T05719                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pig  Pigmentiphaga sp. H8 Brite KEGG Orthology (KO) [BR:pig00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pig03032]     EGT29_15515    03036 Chromosome and associated proteins [BR:pig03036]     EGT29_15515    03400 DNA repair and recombination proteins [BR:pig03400]     EGT29_15515 DNA replication proteins [BR:pig03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EGT29_15515 Chromosome and associated proteins [BR:pig03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EGT29_15515 DNA repair and recombination proteins [BR:pig03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EGT29_15515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 2C_adapt Motif Other DBs NCBI-ProteinID:  AZG09152 UniProt:  A0A3G8GPC9 LinkDB All DBs Position complement(3279285..3279557) Genome browser AA seq 90 aa AA seqDB search MNKTELIDHIAKQADISKAAAGRSLDALVGAVKTTLKKGGTVTLVGFGTFAVSARAARTG RNPRTGEAIKIKKAKVPKFRPGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaccgagcttatcgaccacatcgccaagcaagccgacatttccaaggcggct gccggccgttcgctggatgcgctggtgggagcggtgaaaacgacgctcaagaagggcggc acggtgacgctggtcggtttcggcactttcgcggtgagcgctcgcgcggcccgcaccggc cgtaacccgcgtaccggcgaagccatcaagatcaagaaggccaaggtgccgaagttccgt ccgggcaaggcgctgaaagacgccgtcaactaa

DBGET integrated database retrieval system