Pseudomonas imrae: OQ460_07835 Help Entry OQ460_07835       CDS       T11325                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pim  Pseudomonas imrae Pathway pim01100   Metabolic pathways pim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OQ460_07835 (acpP)    00074 Mycolic acid biosynthesis     OQ460_07835 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OQ460_07835 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XLY94775 LinkDB All DBs Position 1529975..1530211 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEDVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggcgttaaagaa gaagacgtgaagaacgaagcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctcttgaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactgcccaccaggcgtaa

DBGET integrated database retrieval system