Pirellula sp. SH-Sr6A: VN12_06645 Help Entry VN12_06645        CDS       T04360                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pir  Pirellula sp. SH-Sr6A Pathway pir02020   Two-component system pir02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pir00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VN12_06645  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     VN12_06645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pir02035]     VN12_06645 Bacterial motility proteins [BR:pir02035]  Flagellar system   Flagellar assembly proteins    Others     VN12_06645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM CBP30 Motif Other DBs NCBI-ProteinID:  AMV31780 UniProt:  A0A142XZ26 LinkDB All DBs Position 1564524..1564814 Genome browser AA seq 96 aa AA seqDB search MQISGNFSLSGIDAARGASRANAIQAAHSEAKAGLSMPVDQLELSPEALGVEGSSAAGEV FRADKVASLREAIAAGNYDTDEKLSAALDVLLDRLS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcagatttcaggcaatttttcgttatctggcatcgacgcggctcgtggcgcatcgcga gcgaatgcaatccaagcggcacacagcgaagcgaaggccggtttatcgatgcctgtcgat cagcttgagctctcacctgaagcgctcggggtcgaaggatccagtgctgcgggcgaggtc tttcgcgccgacaaggtagcgagtcttcgcgaagccattgcggctggcaattacgacacc gacgaaaagctaagcgctgcgttggatgtattgttggaccgactgagctag

DBGET integrated database retrieval system