Pirellula sp. SH-Sr6A: VN12_16350
Help
Entry
VN12_16350 CDS
T04360
Name
(GenBank) ATPase family associated with various cellular activities (AAA)
KO
K03924
MoxR-like ATPase [EC:3.6.3.-]
Organism
pir
Pirellula sp. SH-Sr6A
Brite
KEGG Orthology (KO) [BR:
pir00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
VN12_16350
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_3
AAA_lid_2
AAA_5
bpMoxR
MCM
AAA
Mg_chelatase
Sigma54_activat
AAA_22
AAA_2
RuvB_N
AAA_24
AAA_16
NACHT
nSTAND3
Motif
Other DBs
NCBI-ProteinID:
AMV33701
LinkDB
All DBs
Position
4085838..4086848
Genome browser
AA seq
336 aa
AA seq
DB search
MSNVAESMQQEADRFRNRYAAVREQIGRVIVGHDDIVNGVLTAMFVGGHCLLEGVPGLGK
TMLIKTLSETLSLDFNRIQFTPDLMPSDILGTNMIVENDGRREFQFQRGPIFTQICLADE
INRATPKTQSALLETMQEGTVTVAGHRYELQKPFFVLATQNPIEQEGTYPLPEAQLDRFL
FKLVVGYSSREELNTIIDRTTRGEVIKPEKVMDGEEIRHWQALVRQVVLAKHVQDYAARL
ILATHPGGKLAPDITNQYIRWGSSPRGAQTIALASKVRALLDGRYNVSFEDIRRVYLPAM
RHRVLLNFEAQAEGIDTDRVLLDILEKVSERADDLN
NT seq
1011 nt
NT seq
+upstream
nt +downstream
nt
atgagtaatgtcgctgaatcgatgcaacaagaagccgatcgctttcgcaatcgctacgcc
gctgttcgcgagcagataggccgcgtcatcgtgggacacgatgacatcgtcaacggcgtc
ttgaccgcgatgtttgtcggcggccattgcttgctcgaaggagtaccggggcttggtaag
acgatgttgatcaagacgctctcggagaccttgtcgctcgacttcaaccggattcagttc
acacccgacttgatgccctccgatatcctcgggaccaatatgatcgtggagaacgatgga
cgccgcgaatttcaattccagcgggggccgatcttcacacagatctgtctagcggatgaa
atcaaccgagccactccgaagacccaatccgctttgcttgaaacgatgcaagagggaacg
gttaccgtcgctgggcatcgctacgagcttcaaaagcccttcttcgtactggcaacgcaa
aacccgatcgaacaagaaggaacctatccattgccggaggcgcaattggaccggtttctt
ttcaagttggtggtgggatattcctcgcgggaagagctcaataccatcatcgatcggacc
acgcgtggagaggtgatcaagcctgaaaaggtgatggatggcgaagagattcgccattgg
caggctttggtgcggcaggttgttctggcgaagcacgttcaagattatgcagccagactc
attctcgcgacacatccgggagggaagttggcacccgacatcaccaatcaatacatacga
tggggctccagtcctcgcggggctcagaccatcgcattggcatccaaggttcgggcattg
ctcgatggccgatacaatgtcagctttgaagatatacgacgtgtttatttgccggccatg
cggcatcgggttttattgaactttgaggcccaggccgaggggattgataccgatcgcgta
ttgctcgatattttggagaaagtctccgaacgagccgacgatttgaattag
DBGET
integrated database retrieval system