Pirellula sp. SH-Sr6A: VN12_18110 Help Entry VN12_18110        CDS       T04360                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pir  Pirellula sp. SH-Sr6A Pathway pir01100   Metabolic pathways pir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VN12_18110 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VN12_18110 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMV34050 UniProt:  A0A142Y5K3 LinkDB All DBs Position 4516961..4517221 Genome browser AA seq 86 aa AA seqDB search MTPAEIRDEILDILSEIAPDEDLSGLDDNKSFREQMELDSMDFLDIVMELRKRHRVQIPE DEYGNLASMASTVAYLEPKMRDIVAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacaccagcggaaatccgtgacgagatcttggatattttgagtgagattgcaccagac gaagatctgtcggggctcgatgacaataaatcgtttcgagaacagatggaactcgatagc atggacttcctcgatattgtgatggagcttcgaaagcgccatcgcgtgcaaattcccgag gatgagtacggcaatctcgccagcatggcatccacggtcgcttatctcgaaccgaaaatg cgggacatcgtcgccgcctaa

DBGET integrated database retrieval system