Pirellula sp. SH-Sr6A: VN12_23735 Help Entry VN12_23735        CDS       T04360                                  Name (GenBank) HIT-like protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism pir  Pirellula sp. SH-Sr6A Brite KEGG Orthology (KO) [BR:pir00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:pir03016]     VN12_23735   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pir04147]     VN12_23735 Transfer RNA biogenesis [BR:pir03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     VN12_23735 Exosome [BR:pir04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VN12_23735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Motif Other DBs NCBI-ProteinID:  AMV35158 UniProt:  A0A142Y7G2 LinkDB All DBs Position 5830031..5830375 Genome browser AA seq 114 aa AA seqDB search MPETVFSKIIRKEIPAKIVYEDDLALAFHDVHPQAPVHVLVIPKQPIQSLAHVSEADVAL LGHLQRVIQQVARQLQIDETGYRVVTNIGRDGGQSVDHIHYHVLGGRSLSWPPG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgccagaaacggtgtttagcaaaattatccgcaaggaaatcccagcgaagatcgtctac gaggacgatcttgccttggcatttcacgatgttcacccccaagctccggtgcatgttctt gttatacccaagcagcctatacagtctttagcccatgtatccgaggcggacgtcgcgctg ctcgggcatctgcaacgggtaatccagcaggtcgccaggcagcttcaaatcgacgagacg ggttatcgtgtcgttacgaatattgggagggatggtggtcagtcagtcgaccacattcat tatcatgtgctaggggggcgttcgttgtcctggccgccgggttga

DBGET integrated database retrieval system