Pyrobaculum islandicum: Pisl_1894 Help Entry Pisl_1894         CDS       T00444                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pis  Pyrobaculum islandicum Pathway pis03010   Ribosome Brite KEGG Orthology (KO) [BR:pis00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Pisl_1894   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Pisl_1894  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pis03011]     Pisl_1894    04121 Ubiquitin system [BR:pis04121]     Pisl_1894   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pis04147]     Pisl_1894 Ribosome [BR:pis03011]  Ribosomal proteins   Eukaryotes    Small subunit     Pisl_1894   Archaea     Pisl_1894 Ubiquitin system [BR:pis04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Pisl_1894 Exosome [BR:pis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Pisl_1894   Exosomal proteins of colorectal cancer cells    Pisl_1894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT Zn_ribbon_RPB9 Ribosomal_L37ae Zn_Ribbon_1 EDR4-like_1st Zn_ribbon_3 Zn_ribbon_NUD DUF1451 DZR zf-C2H2_ZN142 zf-C2H2_FBX41 Zn_Ribbon_TF DUF2387 YhfH Motif Other DBs NCBI-ProteinID:  ABL89041 UniProt:  A1RVQ9 LinkDB All DBs Position complement(1711768..1711971) Genome browser AA seq 67 aa AA seqDB search MSKKAPVQKEEKKRLPRAATWYELDLQKGVFRFKNKFCPKCGSVMAFHREPVPRWHCGKC GFTQFQR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgtctaagaaagcccctgtccagaaggaggagaaaaagaggctcccccgcgccgccact tggtatgaacttgatttacaaaagggagtgtttaggtttaaaaacaaattctgccccaag tgcggctctgtcatggccttccacagagagccggtgccgaggtggcactgcggtaagtgc ggttttacacagttccagaggtag

DBGET integrated database retrieval system