KEGG   Aedoeadaptatus ivorii: NCTC13079_00805
Entry
NCTC13079_00805   CDS       T06636                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
piv  Aedoeadaptatus ivorii
Brite
KEGG Orthology (KO) [BR:piv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:piv03016]
    NCTC13079_00805 (truB)
Enzymes [BR:piv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     NCTC13079_00805 (truB)
Transfer RNA biogenesis [BR:piv03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    NCTC13079_00805 (truB)
 Prokaryotic type
    NCTC13079_00805 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 DKCLD Glyco_hydro_4C
Other DBs
NCBI-ProteinID: VEJ35643
UniProt: A0A448V1C8
LinkDB
Position
1:786550..787449
AA seq 299 aa
MKHSENKSAIGIVAVDKPAGWTSHDVVAKLRRLYHTKQVGHTGTLDPMATGLLPVCVGKA
TKLVEYIARDRKTYLAKAVSGIRTDTGDTTGIVYAKSDLPVPDDLAEILASFVGEQDQIP
PMYSALKYKGKKLYEYARMGICVPRVPRRICVYDLECIDGAADAITLRASVSSGTYIRTL
IDDIGVEASCYFTMAGLRRESVGKLHVEEAHTLDAIEAMSEAEREALLLPMDRMLGHLPA
AEFPASQRLALSQGKSFESPYVEEGENTFRVYTDGEFLGLGEVRTKDGRREFKMKKVLC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaaacattcggaaaataagtcggcgatcggcatcgtggccgtcgacaaacccgcgggt
tggacctctcacgatgtagtggcaaaattgcgccgcctctaccatacgaaacaggtgggg
cataccggcacgttggatccgatggcaaccggtcttttgccggtctgtgtcggcaaggcg
accaagctcgtagagtatatcgccagggaccgaaagacttaccttgcaaaggcggtttct
ggaatccgaaccgacaccggtgatacgacgggaatagtctatgccaagagcgatctcccc
gttccggacgatctggcggaaatccttgcctcctttgtgggagaacaagaccagattccg
ccgatgtattcggcgctgaagtataaaggcaaaaagctgtacgaatacgcgcgcatgggg
atctgcgtgccccgcgtccctagaaggatatgcgtctacgatttagagtgcatcgatggc
gctgccgatgcaatcacattgcgcgcgagtgtctcttccggcacctatattcgaacgctt
atcgacgatatcggcgtggaggcaagctgttattttacgatggcgggattgcggagagag
tcggtgggcaaattgcatgtcgaggaagcacatacactcgatgccatcgaagcgatgtcg
gaggcggaacgcgaagcgcttttgcttccgatggaccgcatgctggggcatttgccggca
gcggagtttccggcgtcgcaacgacttgcgctttcgcagggaaaatcgttcgaatcaccg
tatgtcgaagaaggcgagaacacattccgcgtctataccgacggcgaattcctgggactc
ggcgaagtgcgaaccaaagacggaaggcgagaattcaagatgaaaaaggtattatgttga

DBGET integrated database retrieval system