Aedoeadaptatus ivorii: NCTC13079_00878 Help Entry NCTC13079_00878   CDS       T06636                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism piv  Aedoeadaptatus ivorii Pathway piv01100   Metabolic pathways piv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:piv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13079_00878 (acpP)    00074 Mycolic acid biosynthesis     NCTC13079_00878 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13079_00878 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc Elf4 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  VEJ35715 UniProt:  A0A448V1T2 LinkDB All DBs Position 1:complement(860349..860582) Genome browser AA seq 77 aa AA seqDB search MKERVYRVIAEQLNKDPEDLSRDLHFVEDLNMDSIELVEMVMSLEEEFDVQIDEDRLEGI QTIGDVLDLLETMDIEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagagagagtatatcgcgtaatcgccgaacaactgaacaaagatcccgaggacttg tcccgcgatctgcatttcgtagaagatttgaatatggattccatcgaactcgtcgaaatg gtgatgagcttggaagaggaatttgacgttcagatcgacgaagatcgcctcgaagggatc caaaccatcggcgatgtcttggacctgttggagaccatggatatcgaagaatga

DBGET integrated database retrieval system