Pseudomonas inefficax: RIN61_10870 Help Entry RIN61_10870       CDS       T09811                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pix  Pseudomonas inefficax Brite KEGG Orthology (KO) [BR:pix00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pix03036]     RIN61_10870 Chromosome and associated proteins [BR:pix03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     RIN61_10870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 YebO ZapB Motif Other DBs NCBI-ProteinID:  WNN42286 LinkDB All DBs Position 2430840..2431022 Genome browser AA seq 60 aa AA seqDB search MSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVESMILRLKALEQDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagccgattcgagctgctgatcgaacgtgtcgagcaactaaaacggcaaaatgcactc ctagtagctcaggaaaaatcctggcgcgaagagcgcgcccacctcatcgaaaagaacgag atcgccaagcgcaaggtcgagtcgatgattttacgcctcaaggctctggagcaagactca tga

DBGET integrated database retrieval system