Pseudomonas izuensis: LAB08_R22520 Help Entry LAB08_R22520      CDS       T08555                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism piz  Pseudomonas izuensis Pathway piz00361   Chlorocyclohexane and chlorobenzene degradation piz00362   Benzoate degradation piz00623   Toluene degradation piz01100   Metabolic pathways piz01120   Microbial metabolism in diverse environments piz01220   Degradation of aromatic compounds Module piz_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:piz00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LAB08_R22520    00361 Chlorocyclohexane and chlorobenzene degradation     LAB08_R22520    00623 Toluene degradation     LAB08_R22520 Enzymes [BR:piz01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      LAB08_R22520     1.14.13.244  phenol 2-monooxygenase (NADH)      LAB08_R22520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  BCX67617 LinkDB All DBs Position 2501225..2501584 Genome browser AA seq 119 aa AA seqDB search MPVTAIGAYNAQPLDRQENFHGLQLVYLCWEKHLMFCAPFTFPLPPAMPFGDFIEQVVKP SIAQHPDAARVDFSQALWRLNDRPLTPDNAASLIANGIDHKSLLHLNTPGLNGIAGSFN NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcccgtgacagccatcggcgcctacaacgcccaacccctggaccgccaggaaaacttc cacggcctgcaactggtgtacctgtgctgggaaaaacacctgatgttctgcgcgcccttt acctttccactgccaccggcgatgccgttcggcgacttcatcgagcaggtggtcaagccc tcgattgcccaacacccggatgcggcgcgggtcgatttcagtcaggcgctgtggcgcctc aacgaccggccgctcaccccggacaacgcagcgagcctgattgccaacggcatcgaccac aagagcctgctgcacctcaatacccccggcttgaacggcattgccggcagcttcaactga

DBGET integrated database retrieval system