Penaeus japonicus (kuruma prawn): 122249195 Help Entry 122249195         CDS       T07703                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pja  Penaeus japonicus (kuruma prawn) Pathway pja04137   Mitophagy - animal pja04140   Autophagy - animal pja04144   Endocytosis pja04145   Phagosome pja04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pja00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122249195    04145 Phagosome     122249195    04140 Autophagy - animal     122249195    04137 Mitophagy - animal     122249195    04148 Efferocytosis     122249195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pja04131]     122249195   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pja04147]     122249195    04031 GTP-binding proteins [BR:pja04031]     122249195 Membrane trafficking [BR:pja04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122249195 Exosome [BR:pja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122249195   Exosomal proteins of other body fluids (saliva and urine)    122249195   Exosomal proteins of colorectal cancer cells    122249195   Exosomal proteins of bladder cancer cells    122249195 GTP-binding proteins [BR:pja04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122249195 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 NTPase_1 AAA_24 NACHT AAA_22 AAA_7 ATPase_2 G-alpha AAA_5 ABC_tran SRPRB AAA_14 PRK NB-ARC ATP-synt_ab RNA_helicase TniB Motif Other DBs NCBI-GeneID:  122249195 NCBI-ProteinID:  XP_042865798 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MASRKKILLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNTFKSLDSWRDEFLIQASPRDPDHFPF VVLGNKIDLENRAVSTKRAQQWCHSKNEVPYFETSAKEAINVELAFQTIARNALAQESEV ELYNEFPDQIKLTNDNKAKQDACSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcatcacgcaagaagattctcctgaaggtcatcatcctgggagactctggtgtaggc aaaacatccctcatgaaccagtttgtcaacaagaaattcagcaaccaatacaaggcaacc attggggcagacttcctcacaaaggaggtcatggttgatgacagattggtcacaatgcag atctgggataccgctggtcaagagagattccagtcattaggtgttgcattttatcgcgga gctgattgttgtgttcttgtctatgatgttacatctcccaacaccttcaagtctcttgat tcttggcgcgacgagttcctaattcaagcctcaccaagggaccccgatcacttcccattt gttgtcctgggtaacaagattgatctggagaatagggcggtatcgacgaagcgagcacaa cagtggtgtcatagtaaaaatgaagttccctactttgaaactagtgcgaaggaggccatt aacgtggagctagccttccagaccattgctcgcaatgcacttgctcaggagtctgaggtg gagctctacaatgagtttccagaccagatcaaattgaccaatgacaacaaggccaaacag gatgcgtgctcttgctaa

DBGET integrated database retrieval system