KEGG   Penaeus japonicus (kuruma prawn): 122253402
Entry
122253402         CDS       T07703                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pja  Penaeus japonicus (kuruma prawn)
Pathway
pja00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pja00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    122253402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pja00199]
    122253402
Enzymes [BR:pja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     122253402
Cytochrome P450 [BR:pja00199]
 Cytochrome P450, animal type
  CYP306 family
   122253402
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 122253402
NCBI-ProteinID: XP_042872388
LinkDB
Position
Unknown
AA seq 521 aa
MTSLHSSWPDTGLAGTLVAATLLLALLRILQWVRLCWEMPPGPWGLPLVGYLPWIDPRAP
HLTLTNLVEKYGRVYSLKMGGVSVVVIADPDLIRETFNQKITTGRAPLYLTHGIMKGYGL
ICAEGDLWRDHRKFVLGFMRHHGMKNTGSRGAMEPRIHEVGAQLTKELAQESEGVDISGK
LMHHVGNTMNQLIFGFTYKEDDGTWRWLRYLLEEGTKLVGIAGPLNFLPCLRYLPQYKHI
FSFITDNQRKTHAEYQKIISAHEEDLLREAAAQAAGDETSSDDEAKDTPRHIVDAYVKKR
RQLGENVGSFTYKQLHHVAADLFGAGSETTITTLKWHLLNMALFPDIQTRIQRELDERAK
GRDYVTLGEGEDLPFTQAAIMESQRLRSVVPLGIPHGVSQELRVAGYRVPRDTMILPLLW
FVHHNPDTWPDPELYRPERFLDTEGRVLKHPAFMPFQTGRRRCIGDEFAMMIMFIFTTRI
LLKFRIKLEDELKGDPSQEPVCGITLSPRPFKLVFEPRESK
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgacgtctctccactcctcttggccggacacagggctcgccgggactctggttgctgcc
accctgctgctggcgctcctgcgaatcctccagtgggtgcgcctgtgttgggagatgccc
ccggggccctggggactgcctctggtgggttacctgccgtggatcgacccccgcgcccct
cacctgacgctgacaaacctcgtggagaagtatgggcgtgtgtatagcctgaagatgggc
ggcgtgtccgtggtggtgatcgcagaccccgatctcatccgcgagaccttcaaccagaag
atcacgacggggcgcgcgccgctctacctcacccacggcatcatgaagggttacggcctg
atatgtgccgaaggcgatctgtggcgagatcatcgcaagtttgtgttgggcttcatgagg
caccacggcatgaagaacacggggtcgaggggcgccatggagcccagaatacatgaagtg
ggagctcagctcaccaaggagttagcgcaggagagcgagggggtcgacatctcagggaag
ctcatgcaccacgtgggcaacaccatgaaccagctcatcttcggcttcacgtacaaggag
gacgacggcacgtggcgctggctgaggtacctgctggaggagggcacgaagctggtgggc
attgcgggccctctcaacttcttgccttgtctgagatacctcccgcaatacaagcacatc
ttcagcttcatcacggacaaccagcgcaagacacacgccgagtaccagaagatcatttcg
gcacacgaggaggacctccttcgcgaggccgccgcccaggccgcaggcgacgagacctcc
agtgacgacgaagccaaggacacgccgaggcacatcgtggatgcttacgtaaagaaacga
agacagcttggcgagaacgtgggctccttcacgtacaagcagcttcaccacgtggctgcc
gacctgttcggcgcgggctccgagacgaccatcacgaccctcaaatggcacctcctcaac
atggcgcttttccctgacatacaaacaagaatccagcgcgaactagatgaacgagccaag
ggacgtgactacgtgaccctgggcgagggtgaggacctgcccttcacccaggcagccata
atggaatcgcagcgcctccgcagtgtggttcctttgggcattccacacggcgtgtctcag
gaattgcgcgtggctggctacagggttccccgagacaccatgatcctaccgctcctctgg
ttcgtccaccacaaccccgacacttggcccgatccggagctgtatcgacccgagaggttt
ctcgacacggaaggccgcgtgctcaaacatccggccttcatgcccttccagacgggccgt
cgcaggtgcatcggggacgagttcgccatgatgatcatgttcatctttacgacccggatc
ctgctcaagttcagaatcaagctcgaggacgagttgaagggcgacccatcccaggaacca
gtgtgcggcatcacgctctccccgaggcccttcaagctggtgttcgagccgcgggagtcg
aaatga

DBGET integrated database retrieval system