Penaeus japonicus (kuruma prawn): 122264909 Help Entry 122264909         CDS       T07703                                  Name (RefSeq) polyubiquitin-B-like isoform X1   KO K08770   ubiquitin B/C Organism pja  Penaeus japonicus (kuruma prawn) Pathway pja04120   Ubiquitin mediated proteolysis pja04137   Mitophagy - animal pja04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:pja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122264909  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122264909    04137 Mitophagy - animal     122264909  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pja04121]     122264909   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pja04147]     122264909 Ubiquitin system [BR:pja04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    122264909 Exosome [BR:pja04147]  Exosomal proteins   Exosomal proteins of breast milk    122264909   Exosomal proteins of other body fluids (saliva and urine)    122264909   Exosomal proteins of colorectal cancer cells    122264909   Exosomal proteins of bladder cancer cells    122264909 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 TBK1_ULD UBL_IKK OTU1_UBXL UBL_UBAC1 Motif Other DBs NCBI-GeneID:  122264909 NCBI-ProteinID:  XP_042889932 LinkDB All DBs Position Unknown AA seq 163 aa AA seqDB search MSTMVVHVNTLTGKTVTIDINPQDTVEVLKAILEDREGISADQQRIIYGGIQLEDGRTLA MYKIGSEALLHLCLRLRGGGTSMFFLNVITPSNKVIQTVVNERTTIKELKEMLKNEDQTL KSGRHRVMVADKAMENNKTLGDYEIKSEAVVRIEKMENGCKCM NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgagcacaatggtggtacacgtaaatacgctgactgggaagacggtaaccatagacata aaccctcaagataccgtagaggtattaaaagcaatattagaagatagagaaggtatatca gctgaccaacagcggatcatctacggtggaattcaacttgaggatggaagaacactcgcc atgtacaaaatagggtcggaggctttgttacatctttgtcttcgtctgagaggtggagga acaagcatgtttttcctcaatgtgataacgccctcaaataaggtgattcagacggttgtc aatgaacgaacaaccattaaagagttgaaggaaatgttaaaaaacgaagatcaaacctta aagtctggcaggcatcgtgtgatggtggctgataaggcgatggagaacaataagaccctg ggggattatgaaataaagtcagaagctgtcgtacgaatagaaaagatggaaaacggttgc aagtgtatgtga

DBGET integrated database retrieval system