Penaeus japonicus (kuruma prawn): 122264911 Help Entry 122264911         CDS       T07703                                  Name (RefSeq) polyubiquitin-B-like   KO K04551   ubiquitin B Organism pja  Penaeus japonicus (kuruma prawn) Pathway pja04120   Ubiquitin mediated proteolysis pja04137   Mitophagy - animal pja04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:pja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122264911  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122264911    04137 Mitophagy - animal     122264911  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pja04121]     122264911   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pja04147]     122264911 Ubiquitin system [BR:pja04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    122264911 Exosome [BR:pja04147]  Exosomal proteins   Exosomal proteins of breast milk    122264911   Exosomal proteins of other body fluids (saliva and urine)    122264911   Exosomal proteins of colorectal cancer cells    122264911   Exosomal proteins of bladder cancer cells    122264911 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 OTU1_UBXL DUF641 Motif Other DBs NCBI-GeneID:  122264911 NCBI-ProteinID:  XP_042889936 LinkDB All DBs Position Unknown AA seq 163 aa AA seqDB search MSTLLVYVKTLTGKTVTIEISPQDTVEVLKAKLEDKEGIPPDQQRIIHDGNQLEDGRTLD SYNIKSEAVLHLILRLRGGGTSMFFLNVITPSNKVIQTVVNELTTIKELKEMLENEDQTL KSGRHRVMVADKAMENNKTLGDYDITSEAVVRLEKMENGCICM NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgagcacactgctggtatacgtaaaaacgctgactgggaagacggtaactatagaaata agccctcaagataccgtagaggtattaaaagcaaaattagaagataaagaaggtatacca cctgaccaacaacggatcatccatgatggaaatcaacttgaggatggaaggacactcgat tcgtacaacataaagtcggaggctgtgttacatcttatccttcgtctaagaggtggagga acaagcatgtttttcctcaatgtgataacgccctcaaataaggtgattcagacggttgtc aatgaactgacaaccattaaagagttgaaagaaatgttagaaaacgaagatcaaacctta aagtctggcaggcatcgtgtgatggtggctgataaggcgatggagaacaataagaccctg ggggattatgacataacgtcagaggctgtcgtacgattagaaaagatggaaaacggttgt atctgtatgtga

DBGET integrated database retrieval system