Penaeus japonicus (kuruma prawn): 122267623 Help Entry 122267623         CDS       T07703                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism pja  Penaeus japonicus (kuruma prawn) Pathway pja03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:pja00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122267623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pja03036]     122267623   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pja04147]     122267623 Chromosome and associated proteins [BR:pja03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122267623 Exosome [BR:pja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122267623 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF6397 Motif Other DBs NCBI-GeneID:  122267623 NCBI-ProteinID:  XP_042893614 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MSGRGKSGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGVPAYLAAVMEYLAA EVLELADNAAPDNNKTRIMPRHLQLAIRNDEEDY NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgtggtaagagtggtaaggtcaagggcaagtcaaagtcccgctcgagcagg gccggcctccagtttcctgtaggtaggattcaccgccttctgcgtaagggaaattatgct gaacgtgtcggagcaggtgtacctgcgtacctggctgccgtcatggaatacctggctgct gaggttctcgagctggcagataacgccgcccctgacaacaacaagacccgtatcatgccc cgtcacttgcagctggccatccgtaacgacgaggaagattattga

DBGET integrated database retrieval system