Penaeus japonicus (kuruma prawn): 122267705 Help Entry 122267705         CDS       T07703                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pja  Penaeus japonicus (kuruma prawn) Pathway pja04145   Phagosome pja04148   Efferocytosis pja04310   Wnt signaling pathway pja04620   Toll-like receptor signaling pathway pja05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pja00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     122267705  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122267705    04148 Efferocytosis     122267705  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122267705  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122267705  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pja04131]     122267705   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pja04147]     122267705    04031 GTP-binding proteins [BR:pja04031]     122267705 Membrane trafficking [BR:pja04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122267705  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122267705   Macropinocytosis    Ras GTPases     122267705  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122267705 Exosome [BR:pja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122267705   Exosomal proteins of other body fluids (saliva and urine)    122267705   Exosomal proteins of colorectal cancer cells    122267705   Exosomal proteins of bladder cancer cells    122267705 GTP-binding proteins [BR:pja04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122267705 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Motif Other DBs NCBI-GeneID:  122267705 NCBI-ProteinID:  XP_042893757 LinkDB All DBs Position Unknown AA seq 179 aa AA seqDB search MSKNLKIVTVGDGGVGKTSLLVAYTQGSFSDAHEPTVFENYSGEMVFSGEHYNFTLWDTA GQEDYDRCRVLCYPGTDVFLVCFSVVNKSSFSNVNTTWLPEIRRECGDKVPVVLVGTKID LRKTVKPGAAVTKREGRRLAAQLGMNNYVECSAKTGQGCPEAFRIAIQATLARQTCVLL NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgagtaaaaatctgaagatagtgactgtcggcgacggaggtgtgggcaagacttctctg ctggtggcctacacgcagggatcattttccgacgcacacgaaccaacagtctttgaaaac tacagcggagagatggtgttcagcggagagcattacaatttcaccctgtgggacacggct ggacaagaggactatgatcgttgccgtgtcctctgttaccctgggacagacgtgttcttg gtgtgcttcagcgtggtgaacaaatcctctttcagcaacgtaaacacaacatggctaccg gaaatcaggagggagtgtggagataaagtaccagttgtgcttgtcggcacaaaaatcgac ctccggaagaccgtcaagcctggagcagcagtgacgaagcgcgaggggcgtcgactcgcc gctcaactcggcatgaacaactacgtcgagtgctcggccaagaccggccagggctgcccg gaggctttcagaattgcaatccaggcgacgttggcaagacagacctgtgtcttgctttga

DBGET integrated database retrieval system