Pantoea jilinensis: KTJ90_11995 Help Entry KTJ90_11995       CDS       T08640                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pji  Pantoea jilinensis Pathway pji01100   Metabolic pathways pji01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pji00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KTJ90_11995 (acpP)    00074 Mycolic acid biosynthesis     KTJ90_11995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KTJ90_11995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QXG53358 LinkDB All DBs Position complement(2563834..2564070) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtcaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtgatggctctggaagaagagtttgatactgagattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactatatcaatagccataaaggctaa

DBGET integrated database retrieval system