Pseudoxanthomonas japonensis: LAG73_08120 Help Entry LAG73_08120       CDS       T07964                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pjp  Pseudoxanthomonas japonensis Pathway pjp01100   Metabolic pathways pjp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pjp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LAG73_08120    00074 Mycolic acid biosynthesis     LAG73_08120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LAG73_08120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UBB27028 LinkDB All DBs Position complement(1811050..1811304) Genome browser AA seq 84 aa AA seqDB search MTKNELFDRIATILHDTFEIDPAKITPESRLYDDLDIDSIDAVDLIVQLKPLLGRNLQPD AFKTVRTVQDVVDVLYGLIRDQAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaacgaactattcgaccggatcgccacgatcctgcacgacaccttcgaaatc gatccggcgaagatcacgccggaatcgcgcctgtacgacgacctggacatcgacagcatc gacgcggtcgatctgatcgtccagctcaagccgctgctgggccgcaacctgcaaccggac gcgttcaagaccgtccgcacggtgcaggacgtcgtcgacgtgctgtatggcctgatccgc gaccaagccgcctga

DBGET integrated database retrieval system