Pseudoxanthomonas japonensis: LAG73_11890
Help
Entry
LAG73_11890 CDS
T07964
Symbol
dmeF
Name
(GenBank) CDF family Co(II)/Ni(II) efflux transporter DmeF
Organism
pjp
Pseudoxanthomonas japonensis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Cation_efflux
Motif
Other DBs
NCBI-ProteinID:
UBB24080
LinkDB
All DBs
Position
complement(2589882..2590901)
Genome browser
AA seq
339 aa
AA seq
DB search
MTLSAAAAARRHEHVFDEGNPLAERNTRRAVLLTAAMMVVEIAGGWYFNSMALLADGWHM
SSHALALGLSVFAYRFARRHAQDHRFAFGTWKVEVLGGYTSAILLLGVAALMAIQSVERL
IHPVAIHYREAIVIAVVGLGVNLLCAWWLKDGHAHHHHGHAHAHDHGDHHHGHAGHHHAA
RAHDGHSHGHHVHPGHHDLNLRAAYLHVVADAATSVLAIVALAAGWIWGARWMDSVMGLI
GSALVLSWAWGLLRASGRVLLDAEMDAPVVEEIREVIAAEPDTEITDLHVWRVGRDKYAC
EVALVAARPHSPDHYRRALQVHEELVHVTVEVHEAHPPG
NT seq
1020 nt
NT seq
+upstream
nt +downstream
nt
atgaccctgtcagccgccgccgccgcccgtcgccacgaacacgtcttcgatgaaggcaac
ccgctggccgaacgcaacacccgccgcgcggtgctgttgaccgcggcgatgatggtggtg
gagatcgccggcggctggtacttcaactcgatggcgctgctggccgatggctggcacatg
agttcgcacgcgctggcgctgggactgtcggtgttcgcctaccggttcgcgcgccgccat
gcgcaggaccaccgcttcgcgttcggcacctggaaggttgaagtgctggggggctacacc
agtgcgatcctgctgctcggcgtggccgccctgatggcgatccagtcggtcgaacgcctg
atccatccggtggcgatccattaccgcgaggccatcgtcatcgcggtcgtcggcctgggc
gtgaacctgctctgcgcctggtggctgaaggacggacacgcgcaccaccaccacgggcat
gctcatgcgcacgatcacggggatcaccatcacggtcacgctggacatcaccacgcagcg
cgcgcgcatgacgggcactcccatggccaccacgtgcatcccggccatcacgatctgaat
ctgcgcgccgcctacctgcacgtcgtcgccgatgccgccacctcggtgctggcgatcgtc
gcgctggcggcgggctggatctggggcgcgcgctggatggattcggtaatgggactgatc
ggatcggcgctggtgctgagctgggcctggggcctgctgcgcgcgagtgggcgggtgctg
ctggacgcggagatggatgcgccggtggtggaggagatccgcgaggtgatcgcggccgaa
cccgataccgaaatcaccgacctgcatgtctggcgggttggccgggacaagtacgcctgc
gaggtggcgctggtcgccgcgcggccgcattcgccggatcactaccggcgtgcgttgcag
gtgcacgaggaactggtccacgtcaccgtcgaggtgcatgaggcgcatccgccgggttga
DBGET
integrated database retrieval system