KEGG   Pseudoxanthomonas japonensis: LAG73_11890
Entry
LAG73_11890       CDS       T07964                                 
Symbol
dmeF
Name
(GenBank) CDF family Co(II)/Ni(II) efflux transporter DmeF
Organism
pjp  Pseudoxanthomonas japonensis
SSDB
Motif
Pfam: Cation_efflux
Other DBs
NCBI-ProteinID: UBB24080
LinkDB
Position
complement(2589882..2590901)
AA seq 339 aa
MTLSAAAAARRHEHVFDEGNPLAERNTRRAVLLTAAMMVVEIAGGWYFNSMALLADGWHM
SSHALALGLSVFAYRFARRHAQDHRFAFGTWKVEVLGGYTSAILLLGVAALMAIQSVERL
IHPVAIHYREAIVIAVVGLGVNLLCAWWLKDGHAHHHHGHAHAHDHGDHHHGHAGHHHAA
RAHDGHSHGHHVHPGHHDLNLRAAYLHVVADAATSVLAIVALAAGWIWGARWMDSVMGLI
GSALVLSWAWGLLRASGRVLLDAEMDAPVVEEIREVIAAEPDTEITDLHVWRVGRDKYAC
EVALVAARPHSPDHYRRALQVHEELVHVTVEVHEAHPPG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaccctgtcagccgccgccgccgcccgtcgccacgaacacgtcttcgatgaaggcaac
ccgctggccgaacgcaacacccgccgcgcggtgctgttgaccgcggcgatgatggtggtg
gagatcgccggcggctggtacttcaactcgatggcgctgctggccgatggctggcacatg
agttcgcacgcgctggcgctgggactgtcggtgttcgcctaccggttcgcgcgccgccat
gcgcaggaccaccgcttcgcgttcggcacctggaaggttgaagtgctggggggctacacc
agtgcgatcctgctgctcggcgtggccgccctgatggcgatccagtcggtcgaacgcctg
atccatccggtggcgatccattaccgcgaggccatcgtcatcgcggtcgtcggcctgggc
gtgaacctgctctgcgcctggtggctgaaggacggacacgcgcaccaccaccacgggcat
gctcatgcgcacgatcacggggatcaccatcacggtcacgctggacatcaccacgcagcg
cgcgcgcatgacgggcactcccatggccaccacgtgcatcccggccatcacgatctgaat
ctgcgcgccgcctacctgcacgtcgtcgccgatgccgccacctcggtgctggcgatcgtc
gcgctggcggcgggctggatctggggcgcgcgctggatggattcggtaatgggactgatc
ggatcggcgctggtgctgagctgggcctggggcctgctgcgcgcgagtgggcgggtgctg
ctggacgcggagatggatgcgccggtggtggaggagatccgcgaggtgatcgcggccgaa
cccgataccgaaatcaccgacctgcatgtctggcgggttggccgggacaagtacgcctgc
gaggtggcgctggtcgccgcgcggccgcattcgccggatcactaccggcgtgcgttgcag
gtgcacgaggaactggtccacgtcaccgtcgaggtgcatgaggcgcatccgccgggttga

DBGET integrated database retrieval system