Paenibacillus kyungheensis: PQ456_00195 Help Entry PQ456_00195       CDS       T08956                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pka  Paenibacillus kyungheensis Brite KEGG Orthology (KO) [BR:pka00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pka03032]     PQ456_00195    03036 Chromosome and associated proteins [BR:pka03036]     PQ456_00195    03400 DNA repair and recombination proteins [BR:pka03400]     PQ456_00195 DNA replication proteins [BR:pka03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PQ456_00195 Chromosome and associated proteins [BR:pka03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PQ456_00195 DNA repair and recombination proteins [BR:pka03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PQ456_00195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  WCT55999 UniProt:  A0AAX3M1G5 LinkDB All DBs Position 45496..45768 Genome browser AA seq 90 aa AA seqDB search MNKTDLINNISTSSGLTKRDVETVLNGFLGEITDALTKGDKVQLIGFGTFETRKRAARTG RNPQTGEEINISESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagacttgattaacaacatttccacaagcagcggattgacaaaaagagac gttgaaacagtattgaacggtttccttggtgaaatcacagatgcattaacaaaaggcgat aaagttcaattgatcggttttggtacgtttgaaactcgcaaacgtgcagctcgtaccgga cgcaacccgcaaacaggtgaagaaatcaacatttccgaatctactgttcctgcgttcaaa gcaggtaacaagcttaaagaagcggtaaactaa

DBGET integrated database retrieval system