Pseudomonas knackmussii: PKB_0836 Help Entry PKB_0836          CDS       T03081                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism pkc  Pseudomonas knackmussii Pathway pkc03430   Mismatch repair Brite KEGG Orthology (KO) [BR:pkc00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     PKB_0836  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pkc03400]     PKB_0836 Enzymes [BR:pkc01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      PKB_0836 DNA repair and recombination proteins [BR:pkc03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      PKB_0836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Phage_TAC_11 SHOCT Motif Other DBs NCBI-ProteinID:  CDF82204 UniProt:  A0A024HC81 LinkDB All DBs Position complement(863319..863561) Genome browser AA seq 80 aa AA seqDB search MARKKAVDFEQSLAELQTLVERLESGELSLEDSLGAFEQGIRLTRDCQSALSQAEQKVQI LLERDGELSEAPFDSAGDEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaagaaagccgtcgatttcgagcagtccctcgctgaactgcaaaccctggtg gaacgcctggagagtggcgagctgtccctggaggattcgctcggtgccttcgagcagggc atccgcctgacccgtgattgccagtcggcgctcagccaggccgagcagaaggtgcagatc ctcctggagcgcgatggcgagctgagcgaggcgcccttcgattcggcgggcgacgaagca tga

DBGET integrated database retrieval system