KEGG   Pseudomonas knackmussii: PKB_3623
Entry
PKB_3623          CDS       T03081                                 
Symbol
clcb3
Name
(GenBank) Chloromuconate cycloisomerase
  KO
K01860  chloromuconate cycloisomerase [EC:5.5.1.7]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00361  Chlorocyclohexane and chlorobenzene degradation
pkc00364  Fluorobenzoate degradation
pkc00623  Toluene degradation
pkc01100  Metabolic pathways
pkc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    PKB_3623 (clcb3)
   00361 Chlorocyclohexane and chlorobenzene degradation
    PKB_3623 (clcb3)
   00623 Toluene degradation
    PKB_3623 (clcb3)
Enzymes [BR:pkc01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.7  chloromuconate cycloisomerase
     PKB_3623 (clcb3)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Other DBs
NCBI-ProteinID: CDF84964
UniProt: A0A024HJZ6
LinkDB
Position
3799175..3800287
AA seq 370 aa
MKIEAIDVTLVDVPASRPIQMSFTTVQKQSYAIVQIRAGGLVGIGEGSSVGGPTWSSECA
ETIKVIIETYLAPLLIGKDATNLRELQHLMERAVTGNYSAKAAIDVALHDLKARSLNLPL
SDLIGGAIQQGIPIAWTLASGDTQRDIAIAEEMIERRRHNRFKIKLGVRSPADDLRHIEK
IIERVGDRAAVRVDINQAWDENTASVWIPRLEAAGVELVEQPVARSNFDALRRLSADNGV
AILADESLSSLASAFELARHHCVDAFSLKLCNMGGVANTLKVAAIAEASGIASYGGTMLD
SSIGTAAALHVYATLPTMPFGCELLGPWVLADTLTQTQLEIKDFEIRLPSGPGLGVDIDP
DKLRHFTRAG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaagatcgaagcgatcgatgtgacgctggtggacgtcccagcttcgcgtcccatccag
atgtcgtttaccacggtgcagaagcagagctatgcgatcgtgcagatccgtgcgggcggg
cttgtcggcatcggcgagggcagcagcgtaggtgggccgacttggagttccgaatgcgct
gaaaccatcaaggtcatcatcgaaacgtacttggcgccgctcctgatcggcaaggacgcg
acaaatctgcgagagctccagcacttaatggagcgcgccgtaaccggaaactattcggcc
aaggcggccatcgacgttgcgctgcatgatctgaaggcacgctctctgaacctgccgctg
agcgatttgatcggcggcgcgatccagcagggcatccccattgcctggaccctggcgagc
ggcgacacgcagcgggacatcgcaatcgccgaggaaatgatcgagcggcgccggcacaac
cggttcaagatcaagcttggcgtgcgctccccggcagatgatttgcgccatatcgagaag
attatcgagcgcgtcggtgaccgtgctgcggtgcgggtcgatatcaaccaggcctgggat
gagaacacggcatcggtgtggattccgcgcctggaggcggccggtgtcgaactggtcgaa
cagccggtggcacgcagcaacttcgatgcgcttcggcgcctgtcggccgacaacggggtg
gccatcctggccgatgaaagcctgagctcgctggcgtccgccttcgaactggcgcgccat
cattgcgtcgacgccttctcgctgaagctgtgcaacatgggcggggtggcaaataccctc
aaggtcgctgcgatcgcggaagcctcgggcattgcgtcctatgggggcaccatgttggat
tcatcaatcggcaccgctgctgctctccatgtgtatgccacattgccgacgatgcccttc
ggatgtgaactgctagggccctgggtgttagccgacacgcttacgcagacccaactcgag
atcaaggacttcgagattcggttgccctcgggtcctgggttgggtgttgatatcgatccg
gacaagctgcgccacttcacccgcgcgggttga

DBGET integrated database retrieval system