Pseudomonas kribbensis: DLD99_02500 Help Entry DLD99_02500       CDS       T06348                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pke  Pseudomonas kribbensis Pathway pke01100   Metabolic pathways pke01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pke00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DLD99_02500    00074 Mycolic acid biosynthesis     DLD99_02500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DLD99_02500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXI59381 UniProt:  A0A345RJB5 LinkDB All DBs Position complement(529333..529593) Genome browser AA seq 86 aa AA seqDB search MSDLHREIKLLIIDALGLEDISVDDIGDDQTLFGEGLGLDSVDALELGLAIQKKYGIKID ADAKDTRNHFTNVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgagataaaactgctgatcatcgacgccctgggcctcgaagac atcagcgtcgacgacatcggcgacgaccagacactgttcggcgaaggcctgggcctggat tccgtcgacgctctggaactcggcctggcgattcagaaaaagtacggcatcaagatcgac gccgacgccaaggacacccgcaaccatttcaccaacgtggcgagcctcgcggcgttcgtc acggcaaaacaggcagcttga

DBGET integrated database retrieval system