Pseudomonas kribbensis: DLD99_27660 Help Entry DLD99_27660       CDS       T06348                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pke  Pseudomonas kribbensis Brite KEGG Orthology (KO) [BR:pke00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pke03036]     DLD99_27660 Chromosome and associated proteins [BR:pke03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DLD99_27660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP TPR_MLP1_2 Motif Other DBs NCBI-ProteinID:  AXI64100 UniProt:  A0A345RXT4 LinkDB All DBs Position 6030771..6030980 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNALLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctgattactcgggtc gagcaactaaagagtcaaaacgcactcttactagctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgagtcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system