Paraburkholderia kirstenboschensis: RW095_23065 Help Entry RW095_23065       CDS       T09457                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pkf  Paraburkholderia kirstenboschensis Pathway pkf00998   Biosynthesis of various antibiotics pkf01100   Metabolic pathways pkf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pkf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RW095_23065    00074 Mycolic acid biosynthesis     RW095_23065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RW095_23065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Raf1_N Motif Other DBs NCBI-ProteinID:  WOD19144 UniProt:  A0ABZ0EPN7 LinkDB All DBs Position 1:87192..87443 Genome browser AA seq 83 aa AA seqDB search MSEAEILERIRAIFKENFAIEPERVTPDAHLFEELDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIGAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgtccgaggcagagattcttgaacgcatccgcgccatcttcaaagagaacttcgcaatc gagcccgagcgcgtgacgcccgacgcgcatctgttcgaagagctcgacctggatagcatc gacgccgtcgatctcgcgatcaagctgcaggaaatgaccggccgccggatcaagccggaa gagttcaagtcggtgcgcacggtcggcgacgtgatcggtgctgtcgaatccctgctggcg gcccaaggctga

DBGET integrated database retrieval system