Paraburkholderia kirstenboschensis: RW095_23790 Help Entry RW095_23790       CDS       T09457                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pkf  Paraburkholderia kirstenboschensis Pathway pkf00998   Biosynthesis of various antibiotics pkf01100   Metabolic pathways pkf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pkf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RW095_23790 (acpP)    00074 Mycolic acid biosynthesis     RW095_23790 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RW095_23790 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  WOD19277 UniProt:  A0ABZ0ESD6 LinkDB All DBs Position 1:247160..247399 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgtggccgaa gcggaaatcaagaacgaagcttcgttcgtgaacgacctcggcgccgactcgctggacacg gttgaactcgtgatggccctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcaccaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system