KEGG   Paraburkholderia kirstenboschensis: RW095_24085
Entry
RW095_24085       CDS       T09457                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
pkf  Paraburkholderia kirstenboschensis
Pathway
pkf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RW095_24085 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pkf02022]
    RW095_24085 (phoB)
Two-component system [BR:pkf02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   RW095_24085 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg HTH_11
Other DBs
NCBI-ProteinID: WOD19329
UniProt: A0ABZ0ESJ0
LinkDB
Position
1:308883..309584
AA seq 233 aa
MPSSILVIEDEPAISELISVNLQHAGHCPIRAYNAEQAQNLISDVLPDLVLLDWMLPGKS
GIAFARDLRNNERTKHIPIIMLTARGDEQDKVLGLEIGADDYVTKPFSPKELMARIKAVL
RRRAPQLTEDVVAINGLKLDPATHRVAAHAEGSEIKLDLGPTEFRLLHFFMTHPERVHSR
TQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETVRGSGYRLAKSA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcccagcagcattctcgtcattgaagatgagcccgcgatttccgaactgatttcggtc
aatcttcaacacgccggacactgcccgattcgcgcgtataacgccgagcaggcgcagaac
ctgatcagcgacgtattgcccgacctcgtcctgctcgactggatgctgcctggcaagtcg
ggtattgcgttcgcacgcgacctgcgcaacaacgaacgtacgaagcacattccgatcatc
atgctgaccgcgcgcggcgatgaacaggacaaggtgctcggcctcgaaatcggcgccgac
gactacgtcacgaagccgttttccccgaaagaattgatggcgcgcatcaaggcggtgctg
cgccgccgcgcgccgcagttgaccgaagacgtggtcgcgatcaacgggttgaagctcgac
ccggcaacgcatcgtgtcgcggcgcacgccgaaggcagcgagatcaaactcgatcttggt
ccgaccgaattccgtttgctgcatttcttcatgacgcatcctgagcgcgtgcacagccgc
acccaattgctcgaccaggtgtggggcgaccacgtgttcgtcgaagagcgcacggtggac
gtgcacatcaagcgtctgcgggcggcgctcaagccggccggctgcgatgctatgatcgag
acggtccgcggcagcggctaccgtctggccaaaagcgcttga

DBGET integrated database retrieval system