Paraburkholderia kirstenboschensis: RW095_34975 Help Entry RW095_34975       CDS       T09457                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pkf  Paraburkholderia kirstenboschensis Brite KEGG Orthology (KO) [BR:pkf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pkf03032]     RW095_34975    03036 Chromosome and associated proteins [BR:pkf03036]     RW095_34975    03400 DNA repair and recombination proteins [BR:pkf03400]     RW095_34975 DNA replication proteins [BR:pkf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RW095_34975 Chromosome and associated proteins [BR:pkf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RW095_34975 DNA repair and recombination proteins [BR:pkf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RW095_34975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WOD17977 LinkDB All DBs Position 1:2740915..2741193 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcaggacagaccggcgccagcaaggctcaa accggtgaaacgctggacacgttgcttgaagtgatcaagaagtctgtgtcgaagggtgac gcggtccagttgatcggcttcggcagctttggttcgggcaagcgggcagcgcgtacgggt cgcaatccgaagacaggcgaaaccatcaagattccggccgcaaagaccgtcaagtttacg gctggcaaggcgttcaaagacgcagtcaacaagcgctaa

DBGET integrated database retrieval system