Paramormyrops kingsleyae: 111836778 Help Entry 111836778         CDS       T05788                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism pki  Paramormyrops kingsleyae Pathway pki04621   NOD-like receptor signaling pathway pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111836778 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111836778 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pki03110]     111836778 (txn) Chaperones and folding catalysts [BR:pki03110]  Protein folding catalysts   Protein disulfide isomerase    111836778 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 AhpC-TSA Thioredoxin_8 OST3_OST6 DIM1 Thioredoxin_9 Redoxin Thioredoxin_7 TraF PedC-like T4_deiodinase Glutaredoxin A6-like_Thioredoxin-like_C Fer4_13 Motif Other DBs NCBI-GeneID:  111836778 NCBI-ProteinID:  XP_023654104 Ensembl:  ENSPKIG00000016337 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVREINNQADFDKTLKDAGQKLVVIDFTATWCGPCKAIAPIFQKLSDDYQNVVFLKVDVD EAQDVASSCGVSCMPTFQFYKNGVKIGEFSGADKNKLEEMVKKHM NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtccgtgagattaacaatcaggctgactttgacaagacgctcaaggatgccgggcag aaactggtggtgatagacttcactgccacatggtgtggcccctgcaaggcaatcgcaccc atcttccagaaactctctgatgattaccagaatgtggtctttctgaaggtcgacgtggat gaggcacaggatgtggccagctcctgcggagtaagctgcatgccgacattccagttctat aaaaacggagtgaagataggtgaattttcgggggctgacaaaaataagctggaggagatg gtgaagaaacatatgtga

DBGET integrated database retrieval system