Paramormyrops kingsleyae: 111840579 Help Entry 111840579         CDS       T05788                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism pki  Paramormyrops kingsleyae Pathway pki04137   Mitophagy - animal pki04140   Autophagy - animal pki04144   Endocytosis pki04145   Phagosome pki04148   Efferocytosis pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111840579    04145 Phagosome     111840579    04140 Autophagy - animal     111840579    04137 Mitophagy - animal     111840579    04148 Efferocytosis     111840579  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111840579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pki04131]     111840579   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111840579    04031 GTP-binding proteins [BR:pki04031]     111840579 Membrane trafficking [BR:pki04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111840579 Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111840579   Exosomal proteins of other body fluids (saliva and urine)    111840579   Exosomal proteins of colorectal cancer cells    111840579   Exosomal proteins of bladder cancer cells    111840579 GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111840579 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin NTPase_1 AAA_22 AAA_7 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  111840579 NCBI-ProteinID:  XP_023661322 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRTKASAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccagaaagaaagtgctactcaaagtcattattcttggggactcgggtgttggc aagacttcgctgatgaaccagtatgtgaacaagaagtttagcaaccagtataaagctacc ataggagctgacttcctaacaaaggaagtgatggtggacgacaggctggtcactatgcag atatgggacacagccggtcaggagcgatttcagtcactgggcgttgccttctaccgcgga gcagactgctgtgtgcttgtgtttgacgtcactgcacccaacacctttaagaccctggac agctggagagatgagttcctgatccaggccagcccgcgtgacccggaaaacttccccttt gtagtgctaggaaacaaaattgacctggagaacaggcaggtgacgaccaagcgagcgcag gcttggtgccagagtaagaacaacatcccctattttgagaccagtgccaaggaggccatc aatgtagaccaggccttccaaaccatagcacgcaatgctctgaagcaggagacagaagta gagttgtacaatgagtttccggagccaataaaactggacaagaacgacaggacgaaggct tcggcagaaacgtgcagttgctga

DBGET integrated database retrieval system