Paramormyrops kingsleyae: 111840699 Help Entry 111840699         CDS       T05788                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism pki  Paramormyrops kingsleyae Pathway pki04010   MAPK signaling pathway pki04012   ErbB signaling pathway pki04068   FoxO signaling pathway pki04137   Mitophagy - animal pki04140   Autophagy - animal pki04144   Endocytosis pki04150   mTOR signaling pathway pki04210   Apoptosis pki04218   Cellular senescence pki04370   VEGF signaling pathway pki04371   Apelin signaling pathway pki04510   Focal adhesion pki04540   Gap junction pki04625   C-type lectin receptor signaling pathway pki04810   Regulation of actin cytoskeleton pki04910   Insulin signaling pathway pki04912   GnRH signaling pathway pki04916   Melanogenesis pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111840699    04012 ErbB signaling pathway     111840699    04370 VEGF signaling pathway     111840699    04371 Apelin signaling pathway     111840699    04068 FoxO signaling pathway     111840699    04150 mTOR signaling pathway     111840699  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111840699    04140 Autophagy - animal     111840699    04137 Mitophagy - animal     111840699   09143 Cell growth and death    04210 Apoptosis     111840699    04218 Cellular senescence     111840699   09144 Cellular community - eukaryotes    04510 Focal adhesion     111840699    04540 Gap junction     111840699   09142 Cell motility    04810 Regulation of actin cytoskeleton     111840699  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111840699   09152 Endocrine system    04910 Insulin signaling pathway     111840699    04912 GnRH signaling pathway     111840699    04916 Melanogenesis     111840699  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111840699  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pki04131]     111840699   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111840699    04031 GTP-binding proteins [BR:pki04031]     111840699 Membrane trafficking [BR:pki04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111840699  Endocytosis   Macropinocytosis    Ras GTPases     111840699 Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111840699   Exosomal proteins of colorectal cancer cells    111840699 GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111840699 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  111840699 NCBI-ProteinID:  XP_023661566 Ensembl:  ENSPKIG00000013507 UniProt:  A0A3B3STI8 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDGGQD CMNCRCVVG NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagctagtcgttgtgggagctggtggtgtaggcaagagtgccctgacc atccaactgatccagaaccacttcgtagatgagtacgaccccaccattgaggactcctac cggaagcaggtggttattgatggagagacatgtctgctggacatcctggatacagcaggt caggaggagtacagcgccatgcgggaccagtacatgaggacaggcgagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaagacattcatcagtaccgggaacagatc aagagggtgaaggactcagatgatgtgcccatggtgctggtagggaacaagtgtgacctt ccggcccgcacagtggacacacggcaagcccaggagctggcccgaagctacggcatcccc tacatcgagacctctgccaagacgcggcagggagtagaggatgccttctacaccctagtt cgtgagatcaggcagcacaagcttcgcaagctcaaccctccggatgatggtgggcaggac tgcatgaactgccgctgtgtggtcggttga

DBGET integrated database retrieval system