Paramormyrops kingsleyae: 111840921 Help Entry 111840921         CDS       T05788                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pki  Paramormyrops kingsleyae Pathway pki04382   Cornified envelope formation pki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pki00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     111840921  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111840921  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111840921 Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of microglial cells    111840921 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_11 EH Motif Other DBs NCBI-GeneID:  111840921 NCBI-ProteinID:  XP_023662057 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSDLERAMEMLVTVFYRYSKKTGNSNTLSRSEFKQLMETELSTFLKAQRDPNVVDRIRN DLDANGDGELNFEEFVSLVVGLSVACEQIYQLHEKQEQCRK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccaagtgacctggagagagccatggagatgctggtcacggtcttctaccgttactcc aagaaaacaggcaacagcaacactctttcacgctctgagttcaagcagctgatggagact gagctatctacattcctcaaggcacagagggaccccaatgtcgtggatcgcattaggaat gacttggatgccaacggggatggagagctgaactttgaggagtttgtgtccctggtggtg ggcctatcggtggcatgtgagcagatctaccagctgcatgagaagcaagagcagtgcagg aagtga

DBGET integrated database retrieval system