Paramormyrops kingsleyae: 111853914 Help Entry 111853914         CDS       T05788                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pki  Paramormyrops kingsleyae Pathway pki04010   MAPK signaling pathway pki04012   ErbB signaling pathway pki04068   FoxO signaling pathway pki04137   Mitophagy - animal pki04140   Autophagy - animal pki04150   mTOR signaling pathway pki04210   Apoptosis pki04218   Cellular senescence pki04370   VEGF signaling pathway pki04371   Apelin signaling pathway pki04540   Gap junction pki04625   C-type lectin receptor signaling pathway pki04810   Regulation of actin cytoskeleton pki04910   Insulin signaling pathway pki04912   GnRH signaling pathway pki04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111853914 (nras)    04012 ErbB signaling pathway     111853914 (nras)    04370 VEGF signaling pathway     111853914 (nras)    04371 Apelin signaling pathway     111853914 (nras)    04068 FoxO signaling pathway     111853914 (nras)    04150 mTOR signaling pathway     111853914 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111853914 (nras)    04137 Mitophagy - animal     111853914 (nras)   09143 Cell growth and death    04210 Apoptosis     111853914 (nras)    04218 Cellular senescence     111853914 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     111853914 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111853914 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111853914 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     111853914 (nras)    04912 GnRH signaling pathway     111853914 (nras)    04916 Melanogenesis     111853914 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pki04131]     111853914 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pki04147]     111853914 (nras)    04031 GTP-binding proteins [BR:pki04031]     111853914 (nras) Membrane trafficking [BR:pki04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111853914 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     111853914 (nras) Exosome [BR:pki04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111853914 (nras)   Exosomal proteins of other body fluids (saliva and urine)    111853914 (nras)   Exosomal proteins of breast cancer cells    111853914 (nras)   Exosomal proteins of colorectal cancer cells    111853914 (nras) GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111853914 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  111853914 NCBI-ProteinID:  XP_023687110 Ensembl:  ENSPKIG00000009416 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMMKLNSREDRNQGC LGHSCAVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggagctggaggtgtaggcaagagtgcactgacg atacagctcattcagaaccactttgtggatgagtatgaccccaccattgaggactcgtac agaaagcaggtggtgatcgatggcgagacgtgcctactggacatcctggatacagcaggc caggaggagtacagcgccatgcgggaccagtacatgagaactggggagggcttcctctgt gtcttcgccatcaacaacagcaagtcctttgctgacgtgcacctctacagggagcagatc aaacgggttaaagactctgatgatgttcccatggtgctggtgggtaacaagtgtgacctg gctcgaactgtagacaccaagcaggcccaggaactggcacgcagctatgggattgagttt gtggagacctctgccaaaactagacagggagtagaagatgcattttacacgctggtccgg gagatccgacactaccgcatgatgaaactcaacagcagagaagacaggaaccagggctgt cttggccattcctgtgcggtcatgtaa

DBGET integrated database retrieval system